NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105137_105739

Scaffold Ga0105137_105739


Overview

Basic Information
Taxon OID3300009972 Open in IMG/M
Scaffold IDGa0105137_105739 Open in IMG/M
Source Dataset NameSwitchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)615
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location
Location NameAustin, Texas
CoordinatesLat. (o)30.387Long. (o)-97.7301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102282Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0105137_1057391F102282N/AMVSITPFTAPAASHGETIRFGSLEFPTIPRDGLWAPPPFPPSQTFQFGSLEFIINQLGALRFCEEESAPAAFEESAPPPKLLKLKHWRSIHWRIRKRRPSRLTCV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.