Basic Information | |
---|---|
Taxon OID | 3300010011 Open in IMG/M |
Scaffold ID | Ga0133925_104604 Open in IMG/M |
Source Dataset Name | Beer lees fermenting microbial communities from anaerobic reactor in biotech lab of the University of Hong Kong, China - sample2_75d |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7150 |
Total Scaffold Genes | 15 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Reactor → Draft Genomes Reconstructed From Beer Lees Fermenting Consortia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hong Kong | |||||||
Coordinates | Lat. (o) | 22.3964 | Long. (o) | 114.1095 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075996 | Metagenome / Metatranscriptome | 118 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133925_10460414 | F075996 | N/A | MDMINSATGQAVGILLPFWSYLPTNKVSPKGFLYPVSQVMKEGDVLRFVVLIGDAEDEAPLAGKDFFWQDVKRMFRPKFFCADMTVLFRDRMCNFTALYARKGGLFFNGRRAGDFADAGEVFAHYGLQEVWNLITGDIKPSCCVYKYGRLFVPETEVCLGLVSEKANFPKGYDMKDLARVEKLLEEAGAYKIPEEISLAEVEKKLSKFAEIEKFLDEFSSDRETLLR* |
⦗Top⦘ |