NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130028_100225

Scaffold Ga0130028_100225


Overview

Basic Information
Taxon OID3300010023 Open in IMG/M
Scaffold IDGa0130028_100225 Open in IMG/M
Source Dataset NameTerrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDuke University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2972
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming
CoordinatesLat. (o)44.53408Long. (o)-110.7979Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000855Metagenome / Metatranscriptome859Y
F001381Metagenome / Metatranscriptome709Y
F054900Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0130028_1002251F001381GAGMQYVIATLYVLLWLALAAAAALVLPLWALPASLVQLAVAYVMLRAWLTAAAGGDDGA*
Ga0130028_1002252F000855GAGGMDWLEDFWSKIVSWFDELSAGVHNGIVEWINSLVSIWNGWMDALMHPAQAMPSVPELRWVVDWLGGIADYTRLMYMLVDYVAYASIVQQALIAQLTIVTVGLAFRAWLVIRRVVLVS*
Ga0130028_1002257F054900N/ALMICRARGSIGAMEYERAMLQLMVYCVTLLMLYAVDRWSR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.