Scaffold Ga0130028_100404

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130028_100404

Scaffold Ga0130028_100404

Overview

Basic Information
Taxon OID	3300010023 Open in IMG/M
Scaffold ID	Ga0130028_100404 Open in IMG/M
Source Dataset Name	Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Duke University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2303
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming
Coordinates	Lat. (^o)	44.53408	Long. (^o)	-110.7979	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084271	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130028_1004044	F084271	AGGAG	MSGKYKAETVRVMGIKWIWNYTDRKWTSQTAAGKWSLWWNGRAWLLESPRNAIYTMVKQHRYDAMVSAGYKIAEIEKWLLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.