NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130028_101659

Scaffold Ga0130028_101659


Overview

Basic Information
Taxon OID3300010023 Open in IMG/M
Scaffold IDGa0130028_101659 Open in IMG/M
Source Dataset NameTerrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDuke University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1117
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming
CoordinatesLat. (o)44.53408Long. (o)-110.7979Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000642Metagenome / Metatranscriptome965Y

Sequences

Protein IDFamilyRBSSequence
Ga0130028_1016591F000642N/AIALALCAVAAAVWYMRRREAGAGRVTGWLLLYDDLGGWRVLAASYGDSGIVADGVTYPASLPALRVGRELVWIARCDAAALIDHQALERAREAAALASLWRGGGQWLDLLRVMGVLLPAVFAYFTWAQVSALQALVAQILVLVGDK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.