NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130028_104313

Scaffold Ga0130028_104313


Overview

Basic Information
Taxon OID3300010023 Open in IMG/M
Scaffold IDGa0130028_104313 Open in IMG/M
Source Dataset NameTerrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDuke University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)651
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming
CoordinatesLat. (o)44.53408Long. (o)-110.7979Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003460Metagenome / Metatranscriptome485Y

Sequences

Protein IDFamilyRBSSequence
Ga0130028_1043132F003460AGGGGGMPKAARDERYFHDLQHAYEVLHSVLTPRGLYAEVGMMLLVNLRRPAELRDVSVELVIRGRAIGSPVWRVAETLKVPGRMKLRSVSSVLFGLMMRAAYDIEAAISLPGDDKPQRPGGARP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.