Scaffold Ga0126336_10004116

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126336_10004116

Scaffold Ga0126336_10004116

Overview

Basic Information
Taxon OID	3300010032 Open in IMG/M
Scaffold ID	Ga0126336_10004116 Open in IMG/M
Source Dataset Name	Coral microbial communities from El Islote,Puerto Morelos, Mexico - Siderastrea C C metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8931
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (41.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location Name	El Islote,Puerto Morelos, Mexico
Coordinates	Lat. (^o)	20.9267	Long. (^o)	-86.8313	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063340	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126336_100041164	F063340	AGGTGG	MARVLCGQTLALIMGWIEEVSTGKFRLGPNLIPEFHKDTIPTPTDVPDANNQPTFWKLDGGYLVLSMACNWRFVQLNETIRPSAEFAPTLPLHVYLNVGTSSMVRNRVTDLLREIKYHPQQTTHFEPMHIQYVPVQNELVESVETQVAEINEDLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.