NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126309_10004788

Scaffold Ga0126309_10004788


Overview

Basic Information
Taxon OID3300010039 Open in IMG/M
Scaffold IDGa0126309_10004788 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5182
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8707Long. (o)-122.4274Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004746Metagenome / Metatranscriptome425Y
F023705Metagenome / Metatranscriptome209Y
F035469Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0126309_100047885F035469N/AMVGHERTDGHGGIELPFGYYLECDADLLVLRRSDGSCAAVFNISGVSLFEVELAVREDAD
Ga0126309_100047886F004746AGGAGGLQSSEARRGTVVRVRKGHWKSQFAGMRGTVQDLWGHSEHAAVDVLLEDGRSELFWLPDLFVVDEDIAI*
Ga0126309_100047887F023705GGAVKGKGASFLESREARIGTSVGVSDVGRRRERGLVGTIEKTYGHPDYVAADVRFEDGSVELYWHYQLRRMEEQPLQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.