Scaffold Ga0126310_10000156

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126310_10000156

Scaffold Ga0126310_10000156

Overview

Basic Information
Taxon OID	3300010044 Open in IMG/M
Scaffold ID	Ga0126310_10000156 Open in IMG/M
Source Dataset Name	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	20099
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (69.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location Name	UC McLaughlin Reserve (Lake County, CA)
Coordinates	Lat. (^o)	38.8711	Long. (^o)	-122.4276	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007942	Metagenome / Metatranscriptome	342	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126310_1000015619	F007942	GGA	MASRAVFPLRWRNERLRTLTAEVASRLGISQNELIEQAIEHEVVARGAMLSEDLRAAADRLAELTQEQYERIQARGLESYVAGEGFFDPIQTRAAHRTAAVDSLAVGRPPLGRDVSAIYRSARAELA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.