NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126311_10026162

Scaffold Ga0126311_10026162


Overview

Basic Information
Taxon OID3300010045 Open in IMG/M
Scaffold IDGa0126311_10026162 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3538
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8712Long. (o)-122.4276Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002196Metagenome / Metatranscriptome584Y
F003251Metagenome / Metatranscriptome497Y
F004101Metagenome / Metatranscriptome453Y

Sequences

Protein IDFamilyRBSSequence
Ga0126311_100261621F003251N/AKKGTKMKTRTYTTEAGAKKAAARAYRPAILRLANGRYACFRAGDPLPQGARAVSRWGTDRWRAYD*
Ga0126311_100261623F002196AGGAGGMEHMSEDARVLIRGAKEVHADGHGAETFLPGTYLSFLEAAKRTGIRSDRQRYYDAIEELEYEGAIEWDPGARYARGNKHYLITQRGMRDLGSTGTSAGTVAIQDGQQTLFEG*
Ga0126311_100261627F004101GGAMPAALGYDGAVGYRITAADDEVGVNLTDPEWRALVYVASDHGFSAPHLRLEGGDEAVDVGGADVEELRSALGKALEARDIEKIRTPDGELAYDAIQRVRHVLLSDGVRLARTRA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.