 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300010046 Open in IMG/M |
| Scaffold ID | Ga0126384_10928523 Open in IMG/M |
| Source Dataset Name | Tropical forest soil microbial communities from Panama - MetaG Plot_36 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 788 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama | |||||||
| Coordinates | Lat. (o) | 9.1086 | Long. (o) | -79.8436 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061725 | Metagenome / Metatranscriptome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126384_109285232 | F061725 | GGAG | MAFLGKISSSVVHDYLRQSQSAGRKGELIPIENVRVAEKSGKPSPDSPEFDSNQLSWLLSWIDVERIVQGDTDRKNARRNALIFKLHYVDGFEAAEISRFPGFELTKSGVDAVLARLRKRIQR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |