NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133939_1070700

Scaffold Ga0133939_1070700


Overview

Basic Information
Taxon OID3300010051 Open in IMG/M
Scaffold IDGa0133939_1070700 Open in IMG/M
Source Dataset NameIndustrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAalborg University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1424
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater → Industrial Wastewater Microbial Communities From Reactors Of Effluent Treatment Plant In South Killingholme, Immingham, England

Source Dataset Sampling Location
Location NameSouth Killingholme, Immingham, South Humberside, DN40 3DW, England
CoordinatesLat. (o)53.633367Long. (o)-0.251861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022094Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
Ga0133939_10707001F022094N/AMSLPLFHLPRPAQREWLATRLNRPAPPAAQGMSDGYRFPG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.