Basic Information | |
---|---|
Taxon OID | 3300010052 Open in IMG/M |
Scaffold ID | Ga0133944_1000471 Open in IMG/M |
Source Dataset Name | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 134945 |
Total Scaffold Genes | 110 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 72 (65.45%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid → Microbial Community Associated With The Xenic Strain Of Eucapsis Sp. Utex 1519 |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | UTEX collection | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003272 | Metagenome / Metatranscriptome | 496 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133944_100047116 | F003272 | GGGGG | MIRARHAVLAAAMLMTMGTSVAAEVLDATYRGTMVCDKLPFTSDKMREAIEVTITGGAARYSHVVRLRNVAVEPTAEEGTGKIDGQKIDLQGTWKSGGREYQAKYSGSFVRRSARLKGTQTWTDDGKTVTRACAGAIKRPFKPFLPRARKQAAAGQEIATRSLN* |
⦗Top⦘ |