Scaffold Ga0133944_1001063

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133944_1001063

Scaffold Ga0133944_1001063

Overview

Basic Information
Taxon OID	3300010052 Open in IMG/M
Scaffold ID	Ga0133944_1001063 Open in IMG/M
Source Dataset Name	Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	67083
Total Scaffold Genes	83 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	70 (84.34%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid → Microbial Community Associated With The Xenic Strain Of Eucapsis Sp. Utex 1519

Source Dataset Sampling Location
Location Name	UTEX collection
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023883	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133944_10010638	F023883	GAGG	MPPAPKRKPADDPTAPDPDKNARLETYEQEVERASVDSIAEHPDGSAPPLERLVDAHPEKQRKPLP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.