NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0127461_1010396

Scaffold Ga0127461_1010396


Overview

Basic Information
Taxon OID3300010084 Open in IMG/M
Scaffold IDGa0127461_1010396 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)607
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_40CM_2_52_13(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018143Metagenome / Metatranscriptome236N
F065609Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0127461_10103961F018143N/AAMAVPKFMLSMKEKPFAAISSEAKNRGVTVQELLRAVIVPEWARENLQPSTIPQTTMQITPHQINPSMSSKQRDSKLAITVGQLRT*
Ga0127461_10103962F065609GGAGGMKKVKPGDRVWVKTPRAVVERKVGTIVAAKKTPNGVRYVVEWEVDLFERPNGHHPGYLAHEIVPVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.