NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0127475_1092255

Scaffold Ga0127475_1092255


Overview

Basic Information
Taxon OID3300010095 Open in IMG/M
Scaffold IDGa0127475_1092255 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)971
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015807Metagenome / Metatranscriptome252Y
F059436Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0127475_10922552F015807AGGTGGMPHRPEWMEGMERLVRHNGESRETDRPTWSHHRRCSGGQGARREAGSERLEENHRVVINGSDPER*
Ga0127475_10922553F059436GGAGMNRSAEDGEWSSPHYGGEGTWVPPRRTKVCAGDTVGKSVSDPGRPGIVRWEGMAGIVRHSQTKGRETGNAKPGLKPPMVGADISASEIPTEAVPGVGSGRGTQERGQSKRPRIAAGRAATPVGPKRSTGGGRPRAVWQCRRATSG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.