Basic Information | |
---|---|
Taxon OID | 3300010154 Open in IMG/M |
Scaffold ID | Ga0127503_10317968 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 706 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Willow Creek, Wisconsin | |||||||
Coordinates | Lat. (o) | 45.8056 | Long. (o) | -90.0794 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007612 | Metagenome / Metatranscriptome | 348 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0127503_103179681 | F007612 | N/A | MRGRDIMKTPVILAAAVLVGVSLSGIAQAQSNLNCVKDVTYGKEFLAKFPDAGVACREVKMVGGEKWVRFGAEVKHNKDSRITLDFLNSKGDHAVSPMTFIYTPDATITLENKKVKAASAIEEGDKIVVWIPESRFGLYAQPGVAESKQFRLASDDTTIQR* |
⦗Top⦘ |