Scaffold Ga0136450_100000590

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136450_100000590

Scaffold Ga0136450_100000590

Overview

Basic Information
Taxon OID	3300010240 Open in IMG/M
Scaffold ID	Ga0136450_100000590 Open in IMG/M
Source Dataset Name	Terrestrial oil reservoir microbial community from Kuparuk Formation, Alaska - K2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale Center for Genome Analysis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10332
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (86.96%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	70.4	Long. (^o)	-148.7	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079441	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136450_10000059021	F079441	GGA	MRLESYELVEQLKTLNENIRTLNSILKDWANITNRLDEQIRLLETQRYSSKYWQFEPIEHYDLETLQPGEVTNLLSTTESGAFVLFSSFTTSDKVYWEVRVDDLVIKGTIEDLYNYGLIGYNPRTLWISAGNGGYAVWATPNPYIEYRNKIQVYGKNVGDTEIQYNYIIFRYKYIGGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.