Scaffold Ga0136450_100003900

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136450_100003900

Scaffold Ga0136450_100003900

Overview

Basic Information
Taxon OID	3300010240 Open in IMG/M
Scaffold ID	Ga0136450_100003900 Open in IMG/M
Source Dataset Name	Terrestrial oil reservoir microbial community from Kuparuk Formation, Alaska - K2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale Center for Genome Analysis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1345
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	70.4	Long. (^o)	-148.7	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024691	Metagenome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136450_1000039002	F024691	GGAG	MRYHTEGQRDKRKLKTHIPLLEIKASKRKSTKHDRVLVILSTLVRNFSERVNVDHVKPPIALDKTLKLTDERGRKYDIAFIYEGELFLVEVKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.