Scaffold Ga0134104_1056773

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134104_1056773

Scaffold Ga0134104_1056773

Overview

Basic Information
Taxon OID	3300010276 Open in IMG/M
Scaffold ID	Ga0134104_1056773 Open in IMG/M
Source Dataset Name	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	759
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location Name	USA: Dartmouth College, New Hampshire
Coordinates	Lat. (^o)	43.726	Long. (^o)	-72.1429	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053713	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134104_10567731	F053713	N/A	MKTVGNGRENPSTVPATVFFGREWKWEWKNRTGKRNRYYGISGTESIGREHADYDRESITQNGKIHTTTSNI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.