Basic Information | |
---|---|
Taxon OID | 3300010279 Open in IMG/M |
Scaffold ID | Ga0129313_1107908 Open in IMG/M |
Source Dataset Name | Orangutan group fecal microbial communities from fecal samples from Wisconsin, USA - O1105 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068855 | Metagenome | 124 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129313_11079081 | F068855 | N/A | MCPSSSVPTVEVQGPQARKALAPQGLQDEKERENANVQNAGWLHSFDADYHYHGSDLHYHVNVS |
⦗Top⦘ |