Scaffold Ga0134091_1054516

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134091_1054516

Scaffold Ga0134091_1054516

Overview

Basic Information
Taxon OID	3300010285 Open in IMG/M
Scaffold ID	Ga0134091_1054516 Open in IMG/M
Source Dataset Name	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 2_5_20_6_A2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	812
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location Name	USA: Dartmouth College, New Hampshire
Coordinates	Lat. (^o)	43.726	Long. (^o)	-72.1429	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038199	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134091_10545162	F038199	GAGG	MQYTQAEFLQIIQQYNSTDRKIIKANLKHIMDIYNIKPADIISLGYSPRNVYAWTNKSTNNIPLFGQALHIAVHFDFSITEFLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.