 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300010292 Open in IMG/M |
| Scaffold ID | Ga0126326_1074010 Open in IMG/M |
| Source Dataset Name | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1689 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hawaii, USA | |||||||
| Coordinates | Lat. (o) | 21.2833 | Long. (o) | -157.8469 | Alt. (m) | Depth (m) | 3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088366 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126326_10740102 | F088366 | N/A | MFEVLFCVDTDTVTVMLCDSFIFGSLAIWVTDDIESKVT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |