Scaffold Ga0116204_1002933

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116204_1002933

Scaffold Ga0116204_1002933

Overview

Basic Information
Taxon OID	3300010293 Open in IMG/M
Scaffold ID	Ga0116204_1002933 Open in IMG/M
Source Dataset Name	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9057
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Rwanda: Lake Kivu
Coordinates	Lat. (^o)	-1.78	Long. (^o)	29.2	Alt. (m)		Depth (m)	52
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053663	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116204_10029332	F053663	N/A	MKKRVYAFFFILLILHIGLIISNTKFECSCSILSTEEFSPCCNCPHCVSKRGGFLSACSCHERTELPLGDIPLIKRALCFCGSSNSDFDLPGAKYPILLGENLFPPPALEIHCFLPISFTLSSQVYLTPPEHPS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.