NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116204_1011439

Scaffold Ga0116204_1011439


Overview

Basic Information
Taxon OID3300010293 Open in IMG/M
Scaffold IDGa0116204_1011439 Open in IMG/M
Source Dataset NameAnoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3920
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameRwanda: Lake Kivu
CoordinatesLat. (o)-1.78Long. (o)29.2Alt. (m)Depth (m)52
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006181Metagenome / Metatranscriptome379Y
F038202Metagenome / Metatranscriptome166N
F101030Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0116204_10114396F038202N/AMDPEEDAEAHNQEDAENKPKSNMKIKVTNIVYDTDGESISDLPNEMIVNVEGVIDVESEIADAVSDSTGWCVESYNYEIL*
Ga0116204_10114397F101030N/AMTLAQFQAAFAIAKDFDRDLSNVDDSTLYGYGLNDFKPVHTTLEAVAKTIRWQALQFNGEWNAEALNEVAELGRRNFLVLG*
Ga0116204_10114398F006181N/AMKKNLIHVIYPDEATYSFIAINDLSAEDNLERVFAEWNHGSGMECELFIESKKRSLSVNDIVCVNGRYYQCASYGWIRRSAEFVNQLEKEVAIHPRRFDGGGNSAWFALNEVMRNQSINVTKELV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.