NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134088_10010597

Scaffold Ga0134088_10010597


Overview

Basic Information
Taxon OID3300010304 Open in IMG/M
Scaffold IDGa0134088_10010597 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3947
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008484Metagenome / Metatranscriptome332Y
F019463Metagenome / Metatranscriptome229Y
F027893Metagenome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0134088_100105971F027893N/AIETPLRDVPMVIQSYTAYLIRKLEQCADEKPDEKIEVAADLLLESPEDRAAAERAIETLGSIQSATSARVLAHVISEPVLEEDLEMKAYTCVRTMWPLPRPYIFYSLKPHAHEDIPFRWFQLLIDCGEPSAVDRILEEVLAHAKHPDYQEDLLALVELLAQSRDPQTEEKILQVFNSGQAPSAAREILEGFLRRTDTRRQKDTQIAEPWASLERLYTANKKYLAATKLFDSGDKAEAHRKLDELLRELPEYPLALMLKELL*
Ga0134088_100105973F019463N/AMLVEIGPHLSGCRVITQVVVLENVEEALMVKLQFRIRNNVFNPQDPPRKSTIRPLSLCFPSVEEAALLGEVDETGRVIPRRGVFFLTNLRTGPVIEGFEDCALGEFVKAQLEALSQDGEPPAKCEVHGLDPFLEMAEPDQADRLRDLISVCEFRSNEFTPESAVRFLKESGFFDEYIIWA
Ga0134088_100105974F008484N/AMTTFTHAELRLVRKLATEPPLTVLQIKLACPTHSVCNPLPLFRIYKIDDASFEAQWNGYHDSGPKQIFRFEEIDQPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.