Basic Information | |
---|---|
Taxon OID | 3300010315 Open in IMG/M |
Scaffold ID | Ga0136654_1255601 Open in IMG/M |
Source Dataset Name | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 760 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hawaii, USA | |||||||
Coordinates | Lat. (o) | 21.2833 | Long. (o) | -157.8469 | Alt. (m) | Depth (m) | 3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003656 | Metagenome | 474 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136654_12556011 | F003656 | N/A | MAKQMVKERQDITAGLNSIKGASGKVIVDDKGIKDSWKEYMEKLINEENE |
⦗Top⦘ |