NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136651_10006399

Scaffold Ga0136651_10006399


Overview

Basic Information
Taxon OID3300010330 Open in IMG/M
Scaffold IDGa0136651_10006399 Open in IMG/M
Source Dataset NameMarine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6479
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin, Gulf of California
CoordinatesLat. (o)27.0078Long. (o)-111.4071Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036512Metagenome169N
F040420Metagenome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0136651_1000639912F036512AGGAGMYWKVPNYLKRYIRIQDILKNIFRPCDCGEELKKCEKEKQYCAKRIESLSRTLTHSIVLPEVTEHRKYVKEIKPWKIAKRIGNFDLVTADESYYALPLNSWIDVLNSIQPQVEKVLKKWRRDISDCDDFALVAASAVAASFAYDPFEKQVAFAITWSRSHAYNSFITTEGTWEIYEPQSNAIVGQLGKTTGIYKTEKIWFMG*
Ga0136651_1000639913F040420N/AMVYGIMKIVILFVMGILLSLSLSQFLIVDSTDSHPYINGTYVCRDYSRDLILSASKYHIYLDYIYVPEKNHMMVGLYNPLENSIEIIEPQTDEIIGCVKEDDKNYIRIPVWNSCFYYSNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.