NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129333_10118151

Scaffold Ga0129333_10118151


Overview

Basic Information
Taxon OID3300010354 Open in IMG/M
Scaffold IDGa0129333_10118151 Open in IMG/M
Source Dataset NameFreshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2444
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)39.2637Long. (o)-76.0017Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013526Metagenome / Metatranscriptome270Y
F014496Metagenome / Metatranscriptome262Y
F048252Metagenome / Metatranscriptome148Y
F081257Metagenome / Metatranscriptome114Y
F091432Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0129333_101181511F048252GGAGMMTRKDYVATAEILRYASDKTHPALFSKMVVDFALM
Ga0129333_101181512F013526AGGAMKKNVLISFITEAETDIEAVFALNKILYQLPDSDLVKFDVFDVVECDGVQTK*
Ga0129333_101181514F091432AGGAMDLKEFRDFITAQRLAEIKEKRNANLTAILSVANATITETTRKEN*
Ga0129333_101181515F014496AGGAMKTYSIPDLLVGQTYYPRSLARKYQYGEITFAEKREDIWLDGYEAYAIRFNGNRWATVAVKVAD*
Ga0129333_101181518F081257AGGAGMKLLTYTAEKDSNIVSVNNRLMVSEYQINDLLDSLVNNGYTILTTAVTDGEYSQHLNG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.