Scaffold Ga0134066_10015304

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134066_10015304

Scaffold Ga0134066_10015304

Overview

Basic Information
Taxon OID	3300010364 Open in IMG/M
Scaffold ID	Ga0134066_10015304 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1622
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	USA: Angelo Coastal Reserve, California
Coordinates	Lat. (^o)	39.7181	Long. (^o)	-123.6527	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050598	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134066_100153042	F050598	N/A	AIASAIGMASVFVACRPLAWIAIAISDAYLALVLLFAAILSDDRAFAARWPWITRLFPRRTAALFVVALLLLSIVSGFAGLYVGTEVFSSNKTPGDALYLSLFTLAFTDYSPKPGYGQLVVVGQVASGILYLIAAVPLLISRIATFASP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.