NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136551_1000667

Scaffold Ga0136551_1000667


Overview

Basic Information
Taxon OID3300010388 Open in IMG/M
Scaffold IDGa0136551_1000667 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9394
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (81.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001957Metagenome / Metatranscriptome611Y
F019762Metagenome / Metatranscriptome228Y
F024559Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0136551_100066711F001957AGGAGMNSVDMMHELINRAKNLQEFTITTDVPEDFRFNGVIPFDMEIKEGVIYAKVFGIDFNEAVATFDAYLETCK*
Ga0136551_10006674F019762AGGAGMKLHESIAHTRKEMTIKESEAFRVRMVKHEVISPVGLFSLDLIQESFNKEGEIFQTSTYNFFMTKDELQSLAYGLTA*
Ga0136551_10006676F024559GGAGGMIKSLLKLIVGIALIVAVIVIGPLAGIWSLNVLFPVLAIPYTFETWAAFLLIFGSATGLRFGSR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.