NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136551_1015025

Scaffold Ga0136551_1015025


Overview

Basic Information
Taxon OID3300010388 Open in IMG/M
Scaffold IDGa0136551_1015025 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1549
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006506Metagenome / Metatranscriptome371Y
F010472Metagenome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0136551_10150252F010472GGAGMSQVLTELMSSSHPWAAERAQYALQVHEAVGAGQLSPSEAKEILADLISTEKLQEAAADQQATAALVFGVTQLISLY*
Ga0136551_10150253F006506N/AMKKLIAVLTLALLTGCASIMEMIPSRWDVNQAKSITDIQQQAKRFDCKGDQAAQINSLDQNVEWFVIYSQTKPTRDITKLTDTLQKTIGEYKERLKTGPVSPLYCDLKRKIIIQQTEILAGSVQGRF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.