Scaffold Ga0136847_13630083

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136847_13630083

Scaffold Ga0136847_13630083

Overview

Basic Information
Taxon OID	3300010391 Open in IMG/M
Scaffold ID	Ga0136847_13630083 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1882
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Lake Superior Sediments

Source Dataset Sampling Location
Location Name	Lake Superior, USA
Coordinates	Lat. (^o)	47.1675	Long. (^o)	-89.65985	Alt. (m)		Depth (m)	190
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011879	Metagenome / Metatranscriptome	286	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136847_136300832	F011879	N/A	MESDADSQTRTGYTPAMSSDPLELNDARAEYHARWEAVETFKAHELAAMTEERARQIIQSLGAVEGWRERTDWSGLVEQQAIFHRGRRAWFNFR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.