Scaffold Ga0118731_100638608

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118731_100638608

Scaffold Ga0118731_100638608

Overview

Basic Information
Taxon OID	3300010392 Open in IMG/M
Scaffold ID	Ga0118731_100638608 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	JGI facility at Oak Ridge National Laboratory, Brown University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	600
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa

Source Dataset Sampling Location
Location Name	Rhode Island
Coordinates	Lat. (^o)	40.435	Long. (^o)	-70.483	Alt. (m)		Depth (m)	78
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011006	Metagenome / Metatranscriptome	296	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118731_1006386082	F011006	AGAAG	MKKIIDKFLIKRSIRPYKVVALSTGVIVEHYLNGKLKTEYYV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.