NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134127_13472354

Scaffold Ga0134127_13472354


Overview

Basic Information
Taxon OID3300010399 Open in IMG/M
Scaffold IDGa0134127_13472354 Open in IMG/M
Source Dataset NameTerrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)516
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Kellog Biological Station, Michigan
CoordinatesLat. (o)42.3938Long. (o)-85.3708Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018977Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0134127_134723541F018977AGGLRVWAAATAAPGYLAAVTETGGITSVTESAGRIRAGLARRYGPSLVLLEHHPAPGSGEGMETLDLVRTGADGSPHWSRVWPTPHENPRHAGLERWMAGYGHQIVGRPASWFDGHDDTNR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.