NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136851_12341371

Scaffold Ga0136851_12341371


Overview

Basic Information
Taxon OID3300010413 Open in IMG/M
Scaffold IDGa0136851_12341371 Open in IMG/M
Source Dataset NameMangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)504
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location NameMai Po Marshes at Hong Kong
CoordinatesLat. (o)22.0Long. (o)114.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041287Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0136851_123413712F041287N/AREGRRVNMESCYRCGRKADYICPQCGSKICRSHMELRYVGPDRGFRSRYMCPVCWKVKRRVLNEQMIRADRYQRKLYIVGSGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.