NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0124844_1037943

Scaffold Ga0124844_1037943


Overview

Basic Information
Taxon OID3300010868 Open in IMG/M
Scaffold IDGa0124844_1037943 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1604
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004041Metagenome / Metatranscriptome456Y
F021388Metagenome / Metatranscriptome219N
F053645Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0124844_10379432F053645GGAGGMKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKAGTATSGVSRRVHRKVYRRVAYGTAVAGSGGYDYSSLANCGGGYLAYGTSYVAPCGQYSSSYAIAEERLKAGYSVAPYSYYGPSSSYRRPSRY*
Ga0124844_10379433F004041AGGAGGMAPKSDKSFAKATTKLGLATAIAALWFTAVPITDAAADVQISAARAQAIQQCNRLASRYPLHDWGNLQIRLYRSCMAQHGQQE*
Ga0124844_10379434F021388GAGMRIKRTPNDAGTKLTIEFTYYDNGFVSINGSPKGEYTPDAAERWLASTRFVMQMIEEFRNYINKSKTSV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.