NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133913_10247875

Scaffold Ga0133913_10247875


Overview

Basic Information
Taxon OID3300010885 Open in IMG/M
Scaffold IDGa0133913_10247875 Open in IMG/M
Source Dataset Namenorthern Canada Lakes Co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4730
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001092Metagenome / Metatranscriptome780Y
F003266Metagenome / Metatranscriptome496Y
F004759Metagenome / Metatranscriptome424Y
F042750Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0133913_1024787511F004759AGGAGMDKKDLAQDKKMIKSAIGKHEKNMHPGKPPTKLAKGGKTNEMMLQYGRGLAKVANQRGG*
Ga0133913_102478753F003266GGAMTQTSETAKSVIDIVSVAAAIGSFLNLLTPIFGLIGAVWTLMRIAEMVTGKPFSELIGRKKPDAKHE*
Ga0133913_102478755F001092AGAAGMATVKPTGSVVKSLKKAGFYGASEPKRLAIINKVTTKPQRIKMVDKLFLAKKAKGTKP*
Ga0133913_102478757F042750AGGAGGVIKVAKHTEDCAVQEDGPCTCGTDEVLEELALEEAGLTAED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.