NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139175_108606

Scaffold Ga0139175_108606


Overview

Basic Information
Taxon OID3300010946 Open in IMG/M
Scaffold IDGa0139175_108606 Open in IMG/M
Source Dataset NameWastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAutonomous University of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1318
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location
Location NameAlicante,Spain
CoordinatesLat. (o)38.34Long. (o)-0.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051872Metagenome / Metatranscriptome143N
F054846Metagenome / Metatranscriptome139N

Sequences

Protein IDFamilyRBSSequence
Ga0139175_1086061F051872N/AYLKIRSLSDENHKLKQQQAKRDKEFDRRLRNVEQPIANIAQNEHKQRLDNVSLSLKQAAIDQDFDAIDALLAERDRLMKAEPVAKQEEPLAIDDTNDDGETQEQLQAAAQKWIADNPWYNKLTQAGRDQAAKLEAEYRAKVDCTTEEALAYVAQEMGKDPIVAVLKGKLKSPDVTPRTAERPRVASASESSLDPASRNIYNKMISQGLLKTAAEKSAFIKDALGA*
Ga0139175_1086062F054846AGGAGMSNELDLNDLGLGDNSRAGVNDKPARRGAEGRGQGRESRKSLSEHDTARKPERVPMYQQRTMIDTTLIPEGFHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRHDPDFFSRDEFGRDTPASRGPGALSTNDFFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.