NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138308_164086

Scaffold Ga0138308_164086


Overview

Basic Information
Taxon OID3300010965 Open in IMG/M
Scaffold IDGa0138308_164086 Open in IMG/M
Source Dataset NameMicrobial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1401
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland.

Source Dataset Sampling Location
Location NameLake Cadagno, Switzerland
CoordinatesLat. (o)46.5499Long. (o)8.711Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002433Metagenome / Metatranscriptome559Y
F005503Metagenome / Metatranscriptome398Y
F045086Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0138308_1640863F002433N/AMSVGEWTAVGGLVLAVLTAIYSSMRFMVKSIMRELMPNGGNSIKDQVSRIEERLNQLILELALKK*
Ga0138308_1640864F005503GGAGMTTSEVGLFVIMAIACILWAICSYSVGYKEGHKDGYQRGKTVGRHASSQAVR*
Ga0138308_1640865F045086AGGCGGMGFLDGYEAARARTDRWIATHPTGRIETEIMEFNSEKGFVLVKAQAYRHFDDIVPAGTDYAYGYQGAYQQNMKRWFVEDTVTSAILRVMQLIMGGAERTVRETMEQIEKLPAKVANSEPDYWNTKLADVPSFKTREE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.