NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137675_1003256

Scaffold Ga0137675_1003256


Overview

Basic Information
Taxon OID3300010966 Open in IMG/M
Scaffold IDGa0137675_1003256 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFASTERIS
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1189
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000934Metagenome / Metatranscriptome828Y
F010469Metagenome / Metatranscriptome303Y
F068572Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0137675_10032561F010469AGGCGGMNVIPPVVDTNNIRYADFVRVTTPDAVYRFASTASALTVPAVDSQPFDALGVLIKVGDTQRDIKSTANESTFTLVGIDTAALGWVLGNQIKGSQIEAWKGFFNTDGELLTSGGQGGLHQFFNGYINS
Ga0137675_10032562F000934GGAMSLNQVLAISESVGINDQRFVGQMVSRNQRISTSEIITVVPFAFEMKPMNYLYYGQNRSLLNSLRIPDKSLIQYLNFGTTGWASYIAYQGDMTSGEISTCQWQTSSANKVLVLGSLPTMPSTEYIVKAGDFCQVGLYAYIATADVLRGSGSTVSIPVHRNLISTLSTPVNAVIGEYGTTVSMGGTTYTGITFQVILRDYPTYTLVPCVANDSFIQWTGSFRAFEAVL*
Ga0137675_10032563F068572N/AGPYIASMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.