Scaffold Ga0138324_10424095

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138324_10424095

Scaffold Ga0138324_10424095

Overview

Basic Information
Taxon OID	3300010987 Open in IMG/M
Scaffold ID	Ga0138324_10424095 Open in IMG/M
Source Dataset Name	Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	653
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	18.7998	Long. (^o)	-20.70285	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026772	Metatranscriptome	196	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138324_104240951	F026772	N/A	SKSAFAAGAMLRVLLPVLLVTCEGAMRLNLAARKGPDCECINKNQKGPDCECINSKPAVVLAKAEAKKGPDCECINKNQKGPDCECINAKPAVQTSFIQLRAEPAPEDQLAKEMTHDLEMNFNKIAPFGKEDTAKELQDHAAKTQDTLVDAVENAEVAEIKRAVFRALTRLRAAAIKEFDTIARLETQAIDAYNDAHHYRAENPLTHLHEDEAPVET

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.