Scaffold Ga0114934_10314261

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114934_10314261

Scaffold Ga0114934_10314261

Overview

Basic Information
Taxon OID	3300011013 Open in IMG/M
Scaffold ID	Ga0114934_10314261 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	705
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina → unclassified Nitrospina → Nitrospina sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Kolumbo volcano, Aegean Sea
Coordinates	Lat. (^o)	36.5275	Long. (^o)	25.4914	Alt. (m)		Depth (m)	482
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060428	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114934_103142612	F060428	N/A	MSDNLDKLDFDVSYNIIFGKEEVDLIDIYERKTSSFEAEIPDDKFVTFSSNLIKCFKSKIKDSPNRIRTDTLIEVYRNAEDNYEKSEDCSLSLWCMASVNAFLGIAEASTFNTIPSAEQIENTKKDLEEFKLDLDFDSIENLYLETRREALAEKASNWVEI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.