NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151466_1031693

Scaffold Ga0151466_1031693


Overview

Basic Information
Taxon OID3300011102 Open in IMG/M
Scaffold IDGa0151466_1031693 Open in IMG/M
Source Dataset NameComposted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant re-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSao Paulo State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1432
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant

Source Dataset Sampling Location
Location NameNova Europa, Brazil
CoordinatesLat. (o)-21.818963Long. (o)-48.614275Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088555Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0151466_10316931F088555N/AMYFDETVSSLVRDDISPTLGSPDSYEGPGTGGMVQRKLYLYSDNFQRTYSQVQLTSLNSDSQVQIRYAVDQNGSPGTWQTTLDLPSGNYQTPVPVWVQVTFAPTNEPTLRTDLRHWLQWLEAVAG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.