NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138578_1195604

Scaffold Ga0138578_1195604


Overview

Basic Information
Taxon OID3300011110 Open in IMG/M
Scaffold IDGa0138578_1195604 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1332
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016550Metagenome / Metatranscriptome246Y

Sequences

Protein IDFamilyRBSSequence
Ga0138578_11956041F016550N/ADQEKATKEIKKITSISVDSNMRSVVNRSMAEMLKAKRLDLVKERQDLNVNYGGLFLVHQLTAGGAKMEDIAAQLKAGKKIFDIANDDHANWKQINSDAKKLNKKIDDNIAKYFMDSKKLAALDQTDEYDAKADKVAADSDISKDEYADAQSRYQHLHDLASSQSPTGDANGINQGPGVAPAVASGGKR*
Ga0138578_11956042F016550GAGMTRFFVLVFTVAVAMTAFADDQEKATKEIKQITSISVDANMRSIVNRTMADMLKAKRLDLVNERHDLNVNYGGLFLAHQLTAAGVKMEDIAAQLKAGKKIFDIANDGHANWKEINSEAKKLNKKIDDNIEKNFRDAKKLAAVDQADQYDAKADKVSADSDISKDEYTEAQNRYQHLHDVVSSSQLPIGDANLRNSGAGAGSTSGVSGPPAAVIGAK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.