NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114947_10086798

Scaffold Ga0114947_10086798


Overview

Basic Information
Taxon OID3300011112 Open in IMG/M
Scaffold IDGa0114947_10086798 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1873
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NamePacific Ocean: Mariana Trench
CoordinatesLat. (o)12.6311Long. (o)144.7214Alt. (m)Depth (m)6844
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070301Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0114947_100867982F070301GGAGMTGYLFTIKDPLGQEVQLTEKCYQFHILSEHPELSDVSQITEALESPDLIAQDAVDSQRLVYYRTYQMQPQRWIKVVVEQREVVTAYRVRRLKKGEIIRWQQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.