 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300011116 Open in IMG/M |
| Scaffold ID | Ga0151516_10951 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12749 |
| Total Scaffold Genes | 25 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (76.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.947421 | Long. (o) | 127.818872 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041652 | Metagenome / Metatranscriptome | 159 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151516_1095120 | F041652 | N/A | MALLEELPDEMIVSMFEDGRSHTQICYELGIGRRALEQWIEDNDPNIIARARAKAADKLAVETLSIADGMDIDHAQRDVQRIRTRQWLAERWDQKTYGLQKQAQVTINMQDLRIDALRHVEVISDLSTGEKA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |