NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114922_10813613

Scaffold Ga0114922_10813613


Overview

Basic Information
Taxon OID3300011118 Open in IMG/M
Scaffold IDGa0114922_10813613 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)763
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameAarhus Bay
CoordinatesLat. (o)56.103Long. (o)10.458Alt. (m)Depth (m)27
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005129Metagenome / Metatranscriptome411Y
F092077Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0114922_108136132F005129N/AMKYKVKIEDRSLSINLMHHSIIDLGIFTVKATTHTFLFEAKDTDWGADINETELEFYVNNKRCKYVGFKELYTQLYGNSFATWEADIIRQTEEEVAKQIVKEYPGTDVNY*
Ga0114922_108136133F092077N/AMNKELSPLQRSFKRINELLPDSDQVLLRCNLYTMCTELTNESFVEGINTKY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.