NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151667_1092812

Scaffold Ga0151667_1092812


Overview

Basic Information
Taxon OID3300011255 Open in IMG/M
Scaffold IDGa0151667_1092812 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterToyama Prefectural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)662
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location NameJapan Sea near Toyama Prefecture, JAPAN
CoordinatesLat. (o)37.31041Long. (o)137.23108Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F066838Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0151667_10928121F066838AGGAGGLAQEFFIKSADLENKVRQLLPSQGGLGAGFDLSASTQIVPIIDLTESAEGSNLRQDLQKALSTAGTSYTATSTTTVFNNTGFVRNFGTVY
Ga0151667_10928122F001611N/AMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLNNDLLTTGSQRNRVLVRFTNDTSATRTIRCGVFIGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.