 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300011261 Open in IMG/M |
| Scaffold ID | Ga0151661_1031069 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Toyama Prefectural University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 560 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan Sea near Toyama Prefecture, JAPAN | |||||||
| Coordinates | Lat. (o) | 37.36023 | Long. (o) | 137.9591 | Alt. (m) | Depth (m) | 570 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090867 | Metagenome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0151661_10310691 | F090867 | AGGAGG | MNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHLQDVERFKRRRNELTSLSDAELACTQPTDGFLYYLGGGRID* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |